TA344690 DUS1L antibody

Rabbit Polyclonal Anti-DUS1L Antibody - middle region

See related secondary antibodies

Search for all "DUS1L"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat DUS1L

Product Description for DUS1L

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat DUS1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DUS1L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms tRNA-dihydrouridine synthase 1-like
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P1R4
Immunogen:
The immunogen for anti-DUS1L antibody: synthetic peptide directed towards the middle region of human DUS1L. Synthetic peptide located within the following region: EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF.
GeneID:
64118
Application WB
Background DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRs.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DUS1L (1 products)

Catalog No. Species Pres. Purity   Source  

DUS1L

DUS1L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for DUS1L (1 products)

Catalog No. Species Pres. Purity   Source  

DUS1L overexpression lysate

DUS1L overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn