TA344677 MTMR14 / C3orf29 antibody

Rabbit Polyclonal Anti-MTMR14 Antibody - middle region

See related secondary antibodies

Search for all "MTMR14 / C3orf29"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MTMR14 / C3orf29

Product Description for MTMR14 / C3orf29

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MTMR14 / C3orf29.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MTMR14 / C3orf29

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, Myotubularin-related protein 14, NS5ATP4ABP1, hJumpy
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCE2
Immunogen:
The immunogen for anti-MTMR14 antibody: synthetic peptide directed towards the middle region of human MTMR14. Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS.
GeneID:
64419
Application WB
Background This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal domint centronuclear myopathy. Alterte splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MTMR14 / C3orf29 (3 products)

Catalog No. Species Pres. Purity   Source  

MTMR14 / C3orf29 (transcript variant 3)

MTMR14 / C3orf29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

MTMR14 / C3orf29 (transcript variant 2)

MTMR14 / C3orf29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

MTMR14 / C3orf29 (transcript variant 1)

MTMR14 / C3orf29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for MTMR14 / C3orf29 (2 products)

Catalog No. Species Pres. Purity   Source  

MTMR14 overexpression lysate

MTMR14 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

MTMR14 overexpression lysate

MTMR14 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn