TA344672 ATPAF1 / ATP11 antibody

Rabbit Polyclonal Anti-ATPAF1 Antibody - middle region

See related secondary antibodies

Search for all "ATPAF1 / ATP11"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Rat ATPAF1 / ATP11

Product Description for ATPAF1 / ATP11

Rabbit anti Canine, Human, Rat ATPAF1 / ATP11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ATPAF1 / ATP11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP synthase mitochondrial F1 complex assembly factor 1, ATP11 homolog
Presentation Purified
Reactivity Can, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TC12
Immunogen:
The immunogen for anti-ATPAF1 antibody: synthetic peptide directed towards the middle region of human ATPAF1. Synthetic peptide located within the following region: KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK.
GeneID:
64756
Application WB
Background This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Altertively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn