TA344655 GORASP1 / GOLPH5 antibody

Rabbit Polyclonal Anti-GORASP1 Antibody - N-terminal region

See related secondary antibodies

Search for all "GORASP1 / GOLPH5"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GORASP1 / GOLPH5

Product Description for GORASP1 / GOLPH5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GORASP1 / GOLPH5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GORASP1 / GOLPH5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GRASP65, Golgi peripheral membrane protein p65, Golgi phosphoprotein 5, Golgi reassembly-stacking protein 1, Golgi reassembly-stacking protein of 65 kDa
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BQQ3
Immunogen:
The immunogen for anti-GORASP1 antibody: synthetic peptide directed towards the N terminal of human GORASP1. Synthetic peptide located within the following region: PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV.
GeneID:
64689
Application WB
Background The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several altertively spliced transcript variants of this gene have been identified, but their full-length tures have not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GORASP1 / GOLPH5 (1 products)

Catalog No. Species Pres. Purity   Source  

GORASP1 / GOLPH5

GORASP1 / GOLPH5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn