TA344650 POLR2C antibody

Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region

See related secondary antibodies

Search for all "POLR2C"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat POLR2C

Product Description for POLR2C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat POLR2C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR2C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA-directed RNA polymerase II 33 kDa polypeptide, DNA-directed RNA polymerase II subunit C, DNA-directed RNA polymerase II subunit RPB3, RNA polymerase II subunit 3, RNA polymerase II subunit B3, RPB31, RPB33
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P19387
Immunogen:
The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR.
GeneID:
5432
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLR2C (2 products)

Catalog No. Species Pres. Purity   Source  

POLR2C (1-275, His-tag)

POLR2C Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

POLR2C (1-275, His-tag)

POLR2C Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn