TA344642 MRPS33 antibody

Rabbit Polyclonal Anti-MRPS33 Antibody - middle region

See related secondary antibodies

Search for all "MRPS33"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat MRPS33

Product Description for MRPS33

Rabbit anti Canine, Human, Mouse, Rat MRPS33.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRPS33

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 28S ribosomal protein S33, CGI-139, PTD003, S33mt, mitochondrial
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y291
Immunogen:
The immunogen for anti-Mrps33 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DWYPNHNTYFALMGNLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEG.
GeneID:
51650
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRPS33 (2 products)

Catalog No. Species Pres. Purity   Source  

MRPS33 (transcript variant 2)

MRPS33 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

MRPS33 (full length, N-term HIS tag, transcript variant 1)

MRPS33 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn