TA344403 TFPI2 antibody

Rabbit Polyclonal Anti-TFPI2 Antibody - middle region

See related secondary antibodies

Search for all "TFPI2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human TFPI2

TA344403

More Views

  • TA344403

Product Description for TFPI2

Rabbit anti Human TFPI2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TFPI2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP5, Placental protein 5, TFPI-2, Tissue factor pathway inhibitor 2
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48307
Immunogen:
The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT.
GeneID:
7980
Application WB
IHC
Background TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TFPI2 (1 products)

Catalog No. Species Pres. Purity   Source  

TFPI2 (full length, N-term HIS tag)

TFPI2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for TFPI2 (1 products)

Catalog No. Species Pres. Purity   Source  

TFPI2 overexpression lysate

TFPI2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn