TA344315 Galectin-1 antibody

Rabbit Polyclonal Anti-LGALS1 Antibody - middle region

See related secondary antibodies

Search for all "Galectin-1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rat Galectin-1

TA344315

More Views

  • TA344315

Product Description for Galectin-1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rat Galectin-1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Galectin-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 14 kDa lectin, Beta-galactoside-binding lectin L-14-I, Galaptin, Galectin1, HBL, HPL, LGALS1, Lactose-binding lectin 1, Lectin galactoside-binding soluble 1, MAPK-activating protein PM12, S-Lac lectin 1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09382
Immunogen:
The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM.
GeneID:
3956
Application IHC
WB
Background The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Galectin-1 (7 products)

Catalog No. Species Pres. Purity   Source  

Galectin-1

Galectin-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Galectin-1

Galectin-1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $230.00
  OriGene Technologies, Inc.

Galectin-1 (1-135)

Galectin-1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $600.00
  OriGene Technologies GmbH

Galectin-1 (1-135)

Galectin-1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $250.00
  OriGene Technologies GmbH

Galectin-1

Galectin-1 Human Purified > 95 % by SDS-PAGE and Silver staining E. coli
50 µg / $270.00
  OriGene Technologies GmbH

Galectin-1

Galectin-1 Human Purified > 98 % pure by SDS-PAGE and HPLC analysis. E. coli
  OriGene Technologies GmbH

Galectin-1

Galectin-1 Human Purified > 98 % pure by SDS-PAGE and HPLC analysis. E. coli
  OriGene Technologies GmbH

Positive controls for Galectin-1 (1 products)

Catalog No. Species Pres. Purity   Source  

LGALS1 overexpression lysate

LGALS1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn