TA344214 SHB antibody

Rabbit Polyclonal Anti-SHB Antibody - N-terminal region

See related secondary antibodies

Search for all "SHB"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit SHB

Product Description for SHB

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit SHB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SHB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SH2 domain-containing adapter protein B
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15464
Immunogen:
The immunogen for anti-SHB antibody: synthetic peptide directed towards the N terminal of human SHB. Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA.
GeneID:
6461
Application WB
Background SHB is the adapter protein which regulates several sigl transduction cascades by linking activated receptors to downstream sigling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR sigling. SHB may also play a rol
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SHB (1 products)

Catalog No. Species Pres. Purity   Source  

SHB (full length, N-term HIS tag)

SHB Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for SHB (1 products)

Catalog No. Species Pres. Purity   Source  

SHB overexpression lysate

SHB overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn