TA344191 LZTS2 antibody

Rabbit Polyclonal Anti-LZTS2 Antibody - N-terminal region

See related secondary antibodies

Search for all "LZTS2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat LZTS2

Product Description for LZTS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat LZTS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LZTS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1813, LAPSER1, LZTS2, Leucine zipper putative tumor suppressor 2, hLZTS2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRK4
Immunogen:
The immunogen for anti-LZTS2 antibody: synthetic peptide directed towards the N terminal of human LZTS2. Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL.
GeneID:
84445
Application WB
Background LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axol outgrowth by preventing the for
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LZTS2 (1 products)

Catalog No. Species Pres. Purity   Source  

LZTS2

LZTS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for LZTS2 (1 products)

Catalog No. Species Pres. Purity   Source  

LZTS2 overexpression lysate

LZTS2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn