TA344084 C1QTNF5 antibody

Rabbit Polyclonal Anti-MFRP Antibody

See related secondary antibodies

Search for all "C1QTNF5"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat C1QTNF5

Product Description for C1QTNF5

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat C1QTNF5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C1QTNF5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CTRP5, Complement C1q tumor necrosis factor-related protein 5
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXJ0
Immunogen:
The immunogen for anti-MFRP antibody: synthetic peptide directed towards the middle region of human MFRP. Synthetic peptide located within the following region: HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS.
GeneID:
114902
Application WB
Background MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mR, which also encodes C1q and tumor necrosis factor related protein 5.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C1QTNF5 (1 products)

Catalog No. Species Pres. Purity   Source  

C1QTNF5

C1QTNF5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn