TA344032 ANKRD42 antibody

Rabbit Polyclonal Anti-ANKRD42 Antibody

See related secondary antibodies

Search for all "ANKRD42"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ANKRD42

Product Description for ANKRD42

Rabbit anti Bovine, Canine, Human, Mouse, Rat ANKRD42.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD42

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat domain-containing protein 42
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9B4
Immunogen:
Synthetic peptide peptide directed towards the N terminal of human ANKRD42
AA Sequence:
PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL
GeneID:
338699
Application Western blotting (0.2 - 1.0 µg/ml)
Background ANKRD42 is a 43 kDA 389 amino acid protein containing 9 ANK repeats. Its exact function remains unknown.
General Readings Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog, Rabbit, Guinea Pig, Horse, Pig
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ANKRD42 (1 products)

Catalog No. Species Pres. Purity   Source  

ANKRD42 overexpression lysate

ANKRD42 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn