TA344019 Splicing factor 4 (SF4) antibody

Rabbit Polyclonal Anti-SF4 Antibody

See related secondary antibodies

Search for all "Splicing factor 4 (SF4)"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Splicing factor 4 (SF4)

Product Description for Splicing factor 4 (SF4)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Splicing factor 4 (SF4).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Splicing factor 4 (SF4)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F23858, RBP, RNA-binding protein RBP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWZ8
Immunogen:
The immunogen for anti-SF4 antibody: synthetic peptide directed towards the C terminal of human SF4. Synthetic peptide located within the following region: LGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY.
GeneID:
57794
Application WB
Background SF4 is a member of the SURP family of splicing factors.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Splicing factor 4 (SF4) (1 products)

Catalog No. Species Pres. Purity   Source  

Splicing factor 4 (SF4)

Splicing factor 4 (SF4) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for Splicing factor 4 (SF4) (1 products)

Catalog No. Species Pres. Purity   Source  

SUGP1 overexpression lysate

SUGP1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn