TA344004 RG9MTD2 antibody

Rabbit Polyclonal Anti-RG9MTD2 Antibody

See related secondary antibodies

Search for all "RG9MTD2"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RG9MTD2

Product Description for RG9MTD2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RG9MTD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RG9MTD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RNA (guanine-9-)-methyltransferase domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBZ6
Immunogen:
The immunogen for anti-RG9MTD2 antibody: synthetic peptide directed towards the middle region of human RG9MTD2. Synthetic peptide located within the following region: EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA.
GeneID:
93587
Application WB
Background The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn