TA343985 APOBEC1 complementation factor antibody

Rabbit Polyclonal Anti-A1CF Antibody

See related secondary antibodies

Search for all "APOBEC1 complementation factor"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human APOBEC1 complementation factor

TA343985

More Views

  • TA343985

Product Description for APOBEC1 complementation factor

Rabbit anti Human APOBEC1 complementation factor.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for APOBEC1 complementation factor

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A1CF, ACF, ASP
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ94
Immunogen:
The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP.
GeneID:
29974
Application WB
Background Mammalian apolipoprotein B mR undergoes site-specific C to U deamition, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical R recognition motifs and belongs to the hnRNP R family of R-binding proteins. It has been proposed that this complementation factor functions as an R-binding subunit and docks APOBEC-1 to deamite the upstream cytidine. Studies suggest that the protein may also be involved in other R editing or R processing events. Altertive splicing occurs at this locus and three full-length transcript variants, encoding three distinct isoforms, have been described. Additiol splicing has been observed but the full-length ture of these variants has not been determined.Mammalian apolipoprotein B mR undergoes site-specific C to U deamition, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical R recognition motifs and belongs to the hnRNP R family of R-binding proteins. It has been proposed that this complementation factor functions as an R-binding subunit and docks APOBEC-1 to deamite the upstream cytidine. Studies suggest that the protein may also be involved in other R editing or R processing events. Altertive splicing occurs at this locus and three full-length transcript variants, encoding three distinct isoforms, have been described. Additiol splicing has been observed but the full-length ture of these variants has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for APOBEC1 complementation factor (2 products)

Catalog No. Species Pres. Purity   Source  

APOBEC1 complementation factor (transcript variant 2)

APOBEC1 complementation factor Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

APOBEC1 complementation factor (transcript variant 3)

APOBEC1 complementation factor Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn