TA343981 hnRNP-L like / HNRPLL antibody

Rabbit Polyclonal Anti-HNRPLL Antibody

See related secondary antibodies

Search for all "hnRNP-L like / HNRPLL"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat hnRNP-L like / HNRPLL

Product Description for hnRNP-L like / HNRPLL

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat hnRNP-L like / HNRPLL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for hnRNP-L like / HNRPLL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BLOCK24, Heterogeneous nuclear ribonucleoprotein L-like, SRRF, Stromal RNA-regulating factor
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVV9
Immunogen:
The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL. Synthetic peptide located within the following region: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG.
GeneID:
92906
Application WB
Background HNRPLL contains 3 RRM (R recognition motif) domains and may bind R and plays a role in mR processing.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for hnRNP-L like / HNRPLL (1 products)

Catalog No. Species Pres. Purity   Source  

hnRNP-L like / HNRPLL (transcript variant 1)

hnRNP-L like / HNRPLL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for hnRNP-L like / HNRPLL (1 products)

Catalog No. Species Pres. Purity   Source  

HNRNPLL overexpression lysate

HNRNPLL overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn