TA343894 DAZ3 antibody

Rabbit Polyclonal Anti-DAZ3 Antibody

See related secondary antibodies

Search for all "DAZ3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Guinea Pig, Human, Rat DAZ3

Product Description for DAZ3

Rabbit anti Guinea Pig, Human, Rat DAZ3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DAZ3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Deleted in azoospermia protein 3
Presentation Purified
Reactivity GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NR90
Immunogen:
The immunogen for anti-DAZ3 antibody: synthetic peptide directed towards the middle region of human DAZ3. Synthetic peptide located within the following region: PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF.
GeneID:
57054
Application WB
Background This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an R-binding protein that is important
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn