TA343822 EXOSC7 antibody

Rabbit Polyclonal Anti-EXOSC7 Antibody

See related secondary antibodies

Search for all "EXOSC7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EXOSC7

TA343822

More Views

  • TA343822

Product Description for EXOSC7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EXOSC7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOSC7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Exosome complex exonuclease RRP42, Exosome component 7, KIAA0116, RRP42, Ribosomal RNA-processing protein 42, p8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15024
Immunogen:
The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC.
GeneID:
23016
Application WB
Background EXOSC7 belongs to the Rse PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-R to the mature 5.8S rR.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EXOSC7 (3 products)

Catalog No. Species Pres. Purity   Source  

EXOSC7 (transcript variant 1)

EXOSC7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

EXOSC7 (1-291, His-tag)

EXOSC7 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

EXOSC7 (1-291, His-tag)

EXOSC7 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn