TA343756 TOX4 antibody

Rabbit Polyclonal Anti-TOX4 Antibody

See related secondary antibodies

Search for all "TOX4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish TOX4

Product Description for TOX4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish TOX4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TOX4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C14orf92, Epidermal Langerhans cell protein LCP1, KIAA0737, TOX high mobility group box family member 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94842
Immunogen:
The immunogen for Anti-TOX4 antibody is: synthetic peptide directed towards the C-terminal region of Human TOX4. Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV.
GeneID:
9878
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TOX4 (1 products)

Catalog No. Species Pres. Purity   Source  

TOX4 overexpression lysate

TOX4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn