TA343720 BTBD15 / ZBTB44 antibody

Rabbit Polyclonal Anti-Zbtb44 Antibody

See related secondary antibodies

Search for all "BTBD15 / ZBTB44"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BTBD15 / ZBTB44

Product Description for BTBD15 / ZBTB44

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BTBD15 / ZBTB44.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD15 / ZBTB44

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger and BTB domain-containing protein 44
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3SWU4
Immunogen:
The immunogen for Anti-Zbtb44 antibody is: synthetic peptide directed towards the N-terminal region of Rat Zbtb44. Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC.
GeneID:
363035
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn