TA343712 UHRF1 antibody

Rabbit Polyclonal Anti-UHRF1 Antibody

See related secondary antibodies

Search for all "UHRF1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish UHRF1

TA343712

More Views

  • TA343712

Product Description for UHRF1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish UHRF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UHRF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase UHRF1, ICBP90, Inverted CCAAT box-binding protein of 90 kDa, NP95, Nuclear zinc finger protein Np95, RING finger protein 106, RNF106, Ubiquitin-like PHD and RING finger domain-containing protein 1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96T88
Immunogen:
The immunogen for anti-UHRF1 antibody: synthetic peptide directed towards the N terminal of human UHRF1. Synthetic peptide located within the following region: MGVFAVPPLSADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFH.
GeneID:
29128
Application WB
Background This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific D sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UHRF1 (1 products)

Catalog No. Species Pres. Purity   Source  

UHRF1 (transcript variant 2)

UHRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for UHRF1 (1 products)

Catalog No. Species Pres. Purity   Source  

UHRF1 overexpression lysate

UHRF1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn