TA343699 NFATC2 antibody

Rabbit Polyclonal Anti-NFATC2 Antibody

See related secondary antibodies

Search for all "NFATC2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NFATC2

TA343699

More Views

  • TA343699

Product Description for NFATC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NFATC2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NFATC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NFAT pre-existing subunit, NFAT-1, NFATC2, NFATP, Nuclear factor of activated T-cells, T-cell transcription factor NFAT1, cytoplasmic 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13469
Immunogen:
The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE.
GeneID:
4773
Application WB
IHC
Background This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a D-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alterte transcriptiol splice variants, encoding different isoforms, have been characterized.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NFATC2 (3 products)

Catalog No. Species Pres. Purity   Source  

NFATC2 (transcript variant 2)

NFATC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

NFATC2 (transcript variant 1)

NFATC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

NFATC2 (transcript variant D)

NFATC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for NFATC2 (2 products)

Catalog No. Species Pres. Purity   Source  

NFATC2 overexpression lysate

NFATC2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

NFATC2 overexpression lysate

NFATC2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn