TA343698 MYST4 antibody

Rabbit Polyclonal Anti-MYST4 Antibody

See related secondary antibodies

Search for all "MYST4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MYST4

Product Description for MYST4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MYST4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYST4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Histone acetyltransferase MORF, Histone acetyltransferase MOZ2, Histone acetyltransferase MYST4, KIAA0383, MORF, MOZ, MOZ2, MYST protein 4, Monocytic leukemia zinc finger protein-related factor, SAS2, TIP60 protein 4, YBF2/SAS3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WYB5
Immunogen:
The immunogen for anti-MYST4 antibody: synthetic peptide directed towards the N terminal of human MYST4. Synthetic peptide located within the following region: MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ.
GeneID:
23522
Application WB
Background MYST4 is a histone acetyltransferase which may be involved in both positive and negative regulation of transcription. It is required for RUNX2-dependent transcriptiol activation and May be involved in cerebral cortex development.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn