TA343694 HEY2 antibody

Rabbit Polyclonal Anti-HEY2 Antibody

See related secondary antibodies

Search for all "HEY2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HEY2

Product Description for HEY2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HEY2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HEY2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHLHB32, CHF1, Cardiovascular helix-loop-helix factor 1, Class B basic helix-loop-helix protein 32, GRL, HERP, HERP1, HES-related repressor protein 2, HESR-2, HRT-2, HRT2, Hairy and enhancer of split-related protein 2, Hairy-related transcription factor 2, Hairy/enhancer-of-split related with YRPW motif protein 2, Protein gridlock homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBP5
Immunogen:
The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA.
GeneID:
23493
Application WB
Background HEY2 is a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. HEY2 forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repres
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HEY2 (1 products)

Catalog No. Species Pres. Purity   Source  

HEY2

HEY2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn