TA343676 ELL2 antibody

Rabbit Polyclonal Anti-ELL2 Antibody

See related secondary antibodies

Search for all "ELL2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ELL2

Product Description for ELL2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ELL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ELL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RNA polymerase II elongation factor ELL2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00472
Immunogen:
The immunogen for anti-ELL2 antibody: synthetic peptide directed towards the C terminal of human ELL2. Synthetic peptide located within the following region: PGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE.
GeneID:
22936
Application WB
Background ELL2 is the elongation factor that can increase the catalytic rate of R polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the D.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn