TA343594 PPAR-delta antibody

Rabbit Polyclonal Anti-PPARD Antibody

See related secondary antibodies

Search for all "PPAR-delta"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PPAR-delta

TA343594

More Views

  • TA343594

Product Description for PPAR-delta

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PPAR-delta.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PPAR-delta

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1C2, NUCI, Nuclear hormone receptor 1, Nuclear receptor subfamily 1 group C member 2, PPAR-beta, PPARB, PPARD, Peroxisome proliferator-activated receptor delta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03181
Immunogen:
The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY.
GeneID:
5467
Application WB
IHC
Background PPARD is a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biologic
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPAR-delta (4 products)

Catalog No. Species Pres. Purity   Source  

PPAR-delta (transcript variant 1)

PPAR-delta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

PPAR-delta

PPAR-delta Human Purified > 50 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PPAR-delta

PPAR-delta Human Purified > 50 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PPAR-delta

PPAR-delta Human Purified > 50 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Positive controls for PPAR-delta (2 products)

Catalog No. Species Pres. Purity   Source  

PPARD overexpression lysate

PPARD overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.

PPARD overexpression lysate

PPARD overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn