TA343555 ZNF239 antibody

Rabbit Polyclonal Anti-ZNF239 Antibody

See related secondary antibodies

Search for all "ZNF239"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Goat, Human ZNF239

Product Description for ZNF239

Rabbit anti Goat, Human ZNF239.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF239

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HOK-2, HOK2, MOK-2, MOK2, Zinc finger protein 239
Presentation Purified
Reactivity Gt, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16600
Immunogen:
The immunogen for anti-ZNF239 antibody: synthetic peptide directed towards the N terminal of human ZNF239. Synthetic peptide located within the following region: MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTL.
GeneID:
8187
Application WB
Background ZNF239 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZNF239 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF239 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF239 (transcript variant 1)

ZNF239 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for ZNF239 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF239 overexpression lysate

ZNF239 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn