TA343226 WDR26 antibody

Rabbit Polyclonal Anti-WDR26 Antibody

See related secondary antibodies

Search for all "WDR26"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish WDR26

Product Description for WDR26

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish WDR26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR26

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDW2, CUL4- and DDB1-associated WDR protein 2, MIP2, Myocardial ischemic preconditioning up-regulated protein 2, WD repeat-containing protein 26
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H7D7
Immunogen:
The immunogen for anti-Wdr26 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Wdr26. Synthetic peptide located within the following region: TERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVML.
GeneID:
80232
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 986% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WDR26 (1 products)

Catalog No. Species Pres. Purity   Source  

WDR26 (transcript variant 2)

WDR26 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for WDR26 (1 products)

Catalog No. Species Pres. Purity   Source  

WDR26 overexpression lysate

WDR26 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn