TA343169 PDGFC antibody

Rabbit Polyclonal Anti-PDGFC Antibody

See related secondary antibodies

Search for all "PDGFC"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PDGFC

Product Description for PDGFC

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PDGFC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDGFC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fallotein, PDGF C, PDGF-C, Platelet-derived growth factor C, SCDGF, Spinal cord-derived growth factor, VEGF-E
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRA1
Immunogen:
The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS.
GeneID:
56034
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 929% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDGFC (3 products)

Catalog No. Species Pres. Purity   Source  

PDGFC (transcript variant 1)

PDGFC Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
20 µg / $230.00
  OriGene Technologies, Inc.

PDGFC (PDGF-CC)

PDGFC Human Purified > 98 % pure by SDS-PAGE gel and HPLC analyses. E. coli
  OriGene Technologies GmbH

PDGFC (PDGF-CC)

PDGFC Human Purified > 98 % pure by SDS-PAGE gel and HPLC analyses. E. coli
  OriGene Technologies GmbH

Positive controls for PDGFC (1 products)

Catalog No. Species Pres. Purity   Source  

PDGFC overexpression lysate

PDGFC overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn