TA343151 EIF4B antibody

Rabbit Polyclonal Anti-EIF4B Antibody

See related secondary antibodies

Search for all "EIF4B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat EIF4B

Product Description for EIF4B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat EIF4B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF4B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Eukaryotic translation initiation factor 4B, eIF-4B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P23588
Immunogen:
The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV.
GeneID:
1975
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 910% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF4B (1 products)

Catalog No. Species Pres. Purity   Source  

EIF4B

EIF4B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn