TA343110 LIPA antibody

Rabbit Polyclonal Anti-LIPA Antibody

See related secondary antibodies

Search for all "LIPA"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat, Sheep LIPA

TA343110

More Views

  • TA343110

Product Description for LIPA

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat, Sheep LIPA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LIPA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acid cholesteryl ester hydrolase, Cholesteryl esterase, EC=3.1.1.13, LAL, LIPA, Lipase A, Lysosomal acid lipase/cholesteryl ester hydrolase, Sterol esterase
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P38571
Immunogen:
The immunogen for anti-LIPA antibody: synthetic peptide directed towards the N terminal of human LIPA. Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD.
GeneID:
3988
Application WB
Background This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Altertively spliced transcript variants encoding the same protein have been found for this gene.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 869% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LIPA (1 products)

Catalog No. Species Pres. Purity   Source  

LIPA (transcript variant 2)

LIPA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for LIPA (1 products)

Catalog No. Species Pres. Purity   Source  

LIPA overexpression lysate

LIPA overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn