TA343094 CCS / SOD4 antibody

Rabbit Polyclonal Anti-CCS Antibody

See related secondary antibodies

Search for all "CCS / SOD4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish CCS / SOD4

Product Description for CCS / SOD4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish CCS / SOD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCS / SOD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SOD-4, Superoxide Dismutase Copper Chaperone
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14618
Immunogen:
The immunogen for anti-CCS antibody: synthetic peptide directed towards the middle region of human CCS. Synthetic peptide located within the following region: LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA.
GeneID:
9973
Application WB
Background Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 853% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCS / SOD4 (2 products)

Catalog No. Species Pres. Purity   Source  

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for CCS / SOD4 (1 products)

Catalog No. Species Pres. Purity   Source  

CCS overexpression lysate

CCS overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn