TA343046 MIA2 antibody

Rabbit Polyclonal Anti-MIA2 Antibody

See related secondary antibodies

Search for all "MIA2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human MIA2

Product Description for MIA2

Rabbit anti Human MIA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MIA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Melanoma inhibitory activity protein 2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PC5-2
Immunogen:
The immunogen for anti-MIA2 antibody: synthetic peptide directed towards the C terminal of human MIA2. Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT.
GeneID:
117153
Application WB
Background MIA2 may play a role in the pathophysiology of liver disease and may serve as a marker of liver damage.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 804% sucrose.
State:
Purified

Accessory Products

  • LinkedIn