TA343025 RAB2B antibody

Rabbit Polyclonal Anti-RAB2B Antibody

See related secondary antibodies

Search for all "RAB2B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Porcine RAB2B

Product Description for RAB2B

Rabbit anti Canine, Human, Porcine RAB2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rab-2B, Ras-related protein Rab-2B
Presentation Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WUD1
Immunogen:
The immunogen for anti-RAB2B antibody: synthetic peptide directed towards the C terminal of human RAB2B. Synthetic peptide located within the following region: NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS.
GeneID:
84932
Application WB
Background Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 783% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB2B (3 products)

Catalog No. Species Pres. Purity   Source  

RAB2B

RAB2B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

RAB2B (1-216, His-tag)

RAB2B Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

RAB2B (1-216, His-tag)

RAB2B Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for RAB2B (1 products)

Catalog No. Species Pres. Purity   Source  

RAB2B overexpression lysate

RAB2B overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn