TA342684 RAB4A / RAB4 antibody

Rabbit Polyclonal Anti-RAB4A Antibody

See related secondary antibodies

Search for all "RAB4A / RAB4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RAB4A / RAB4

Product Description for RAB4A / RAB4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RAB4A / RAB4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB4A / RAB4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rab-4A, Ras-related protein Rab-4A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P20338
Immunogen:
The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG.
GeneID:
5867
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 441% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB4A / RAB4 (3 products)

Catalog No. Species Pres. Purity   Source  

RAB4A / RAB4

RAB4A / RAB4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

RAB4A / RAB4 (1-218, His-tag)

Recombinant human RAB4A, 1-218aa, His-tagged Human Purified > 90 % E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

RAB4A / RAB4 (1-218, His-tag)

Recombinant human RAB4A, 1-218aa, His-tagged Human Purified > 90 % E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn