TA342665 ALDH9A1 / ALDH9 antibody

Rabbit Polyclonal Anti-ALDH9A1 Antibody

See related secondary antibodies

Search for all "ALDH9A1 / ALDH9"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ALDH9A1 / ALDH9

TA342665

More Views

  • TA342665
  • TA342665

Product Description for ALDH9A1 / ALDH9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ALDH9A1 / ALDH9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALDH9A1 / ALDH9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 4-trimethylaminobutyraldehyde dehydrogenase, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49189
Immunogen:
The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC.
GeneID:
223
Application WB
Background This protein belongs to the aldehyde dehydrogese family of proteins. It has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogetion of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54-kD subunits.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 422% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALDH9A1 / ALDH9 (1 products)

Catalog No. Species Pres. Purity   Source  

ALDH9A1 / ALDH9

ALDH9A1 / ALDH9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn