TA342625 Synaptotagmin-11 antibody

Rabbit Polyclonal Anti-SYT11 Antibody

See related secondary antibodies

Search for all "Synaptotagmin-11"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synaptotagmin-11

Product Description for Synaptotagmin-11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synaptotagmin-11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Synaptotagmin-11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0080, SYT-11, SYT11, Synaptotagmin 11, Synaptotagmin XI, SytXI
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BT88
Immunogen:
The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE.
GeneID:
23208
Application WB
Background This gene is a member of the syptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in syptic transmission. The encoded protein is also a substrate for ubiquitin-E3-ligase parkin. The gene has previously been referred to as syptotagmin XII but has been remed syptotagmin XI to be consistent with mouse and rat official nomenclature.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 382% sucrose.
State:
Purified

Accessory Products

  • LinkedIn