TA342355 NEOT2 antibody

Rabbit Polyclonal Anti-NETO2 Antibody

See related secondary antibodies

Search for all "NEOT2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NEOT2

TA342355

More Views

  • TA342355

Product Description for NEOT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NEOT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NEOT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTCL2, Neuropilin and tolloid-like protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NC67
Immunogen:
The immunogen for anti-NETO2 antibody: synthetic peptide directed towards the N terminal of human NETO2. Synthetic peptide located within the following region: ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME.
GeneID:
81831
Application WB
Background This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate sigling in the brain by regulating kaite receptor function. Expression of this gene may be a biomarker for proliferating infantile hemangiomas. A pseudogene of this gene is located on the long arm of chromosome 8. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 102% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for NEOT2 (1 products)

Catalog No. Species Pres. Purity   Source  

NETO2 overexpression lysate

NETO2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn