TA342324 Thyrotroph embryonic factor (TEF) antibody

Rabbit Polyclonal Anti-TEF Antibody

See related secondary antibodies

Search for all "Thyrotroph embryonic factor (TEF)"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Sheep Thyrotroph embryonic factor (TEF)

Product Description for Thyrotroph embryonic factor (TEF)

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Sheep Thyrotroph embryonic factor (TEF).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Thyrotroph embryonic factor (TEF)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1655
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q10587
Immunogen:
The immunogen for anti-TEF antibody: synthetic peptide directed towards the N terminal of mouse TEF. Synthetic peptide located within the following region: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL.
GeneID:
7008
Application WB
Background Transcription factor that binds to and transactivates the TSHB promoter. Binds to a minimal D-binding sequence 5'-[TC][AG][AG]TTA[TC][AG]-3' (By similarity). Also activates the telokin promoter in smooth muscle-specific and calcium-dependent manner.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 71% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Thyrotroph embryonic factor (TEF) (2 products)

Catalog No. Species Pres. Purity   Source  

Thyrotroph embryonic factor (TEF) (1-303, His-tag)

Thyrotroph embryonic factor (TEF) Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $820.00
  OriGene Technologies GmbH

Thyrotroph embryonic factor (TEF) (1-303, His-tag)

Thyrotroph embryonic factor (TEF) Human Purified > 85 % by SDS - PAGE E. coli
20 µg / $320.00
  OriGene Technologies GmbH

Positive controls for Thyrotroph embryonic factor (TEF) (1 products)

Catalog No. Species Pres. Purity   Source  

TEF overexpression lysate

TEF overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn