TA342301 FIGLA antibody

Rabbit Polyclonal Anti-Figla Antibody

See related secondary antibodies

Search for all "FIGLA"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Mouse, Rat FIGLA

Product Description for FIGLA

Rabbit anti Mouse, Rat FIGLA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FIGLA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Class C basic helix-loop-helix protein 8, FIG alpha, Factor in the germline alpha, Folliculogenesis-specific basic helix-loop-helix protein, Transcription factor FIGa, bHLHc8
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O55208
Immunogen:
The immunogen for anti-Figla antibody is: synthetic peptide directed towards the C-terminal region of Mouse Figla. Synthetic peptide located within the following region: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS.
GeneID:
26910
Application WB
Background Figla is a germ-line specific transcription factor implicated in posttal oocyte-specific gene expression. It plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zo pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. It is essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additiol pathways that are essential for normal ovarian development. Figla binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 48% sucrose.
State:
Purified

Accessory Products

  • LinkedIn