TA342287 ROR-gamma / RORC antibody

Rabbit Polyclonal Anti-Rorc Antibody

See related secondary antibodies

Search for all "ROR-gamma / RORC"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rat ROR-gamma / RORC

Product Description for ROR-gamma / RORC

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rat ROR-gamma / RORC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ROR-gamma / RORC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1F3, Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, RORG, RZRG, Retinoid-related orphan receptor-gamma
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51449
Immunogen:
The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG.
GeneID:
6097
Application WB
Background Rorc is an orphan nuclear receptor. Isoform 2 negatively regulates expression of TNFSF6/FASL and IL2 production in T-cells. It also binds to the TEA promoter and may participate in the regulation of D accessibility in the TCR-Jalpha locus.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 34% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ROR-gamma / RORC (1 products)

Catalog No. Species Pres. Purity   Source  

ROR-gamma / RORC (transcript variant 1)

ROR-gamma / RORC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn