TA342198 RPA1 antibody

Rabbit polyclonal Anti-RPA1 Antibody

See related secondary antibodies

Search for all "RPA1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat, Sheep RPA1

TA342198

More Views

  • TA342198
  • TA342198
  • TA342198

Product Description for RPA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat, Sheep RPA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms REPA1, RF-A protein 1, RFA1, RP-A p70, RPA70, Replication factor A protein 1, Replication protein A, Replication protein A 70 kDa DNA-binding subunit, Single-stranded DNA-binding protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P27694
Immunogen:
The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA.
GeneID:
6117
Application WB
Background RPA1 plays an essential role in several cellular processes in D metabolism including replication, recombition and D repair. RPA1 binds and subsequently stabilizes single-stranded D intermediates and thus prevents complementary D from reannealing
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPA1 (1 products)

Catalog No. Species Pres. Purity   Source  

RPA1

RPA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for RPA1 (1 products)

Catalog No. Species Pres. Purity   Source  

RPA1 overexpression lysate

RPA1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn