TA342166 PSMB3 antibody

Rabbit polyclonal Anti-PSMB3 Antibody

See related secondary antibodies

Search for all "PSMB3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Mouse, Rabbit, Rat, Zebrafish PSMB3

Product Description for PSMB3

Rabbit anti Bovine, Canine, Guinea Pig, Mouse, Rabbit, Rat, Zebrafish PSMB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMB3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Proteasome 20S beta 3, Proteasome chain 13, Proteasome component C10-II, Proteasome subunit beta type-3, Proteasome theta chain
Presentation Purified
Reactivity Bov, Can, GP, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49720
Immunogen:
The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF.
GeneID:
5691
Application WB
Background The proteasome is a multicatalytic proteise complex with a highly ordered ring-shaped 20S core structure.The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome,The immunoproteasome, isThe processing of class I MHC peptides.This gene encodes a member ofThe proteasome B-type family, also known asThe T1B family, that is a 20S core beta subunit.The 26 S proteasome may be involved in trinucleotide repeat expansion, a phenomenon which is associated with many hereditary neurological diseases. Pseudogenes have been identified on chromosomes 2 and 12. Altertive splicing results in multiple transcript variants [provided by RefSeq, Sep 2013].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMB3 (2 products)

Catalog No. Species Pres. Purity   Source  

PSMB3 (1-205, His-tag)

PSMB3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $1,070.00
  OriGene Technologies GmbH

PSMB3 (1-205, His-tag)

PSMB3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $400.00
  OriGene Technologies GmbH

Positive controls for PSMB3 (1 products)

Catalog No. Species Pres. Purity   Source  

PSMB3 overexpression lysate

PSMB3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn