TA342072 GALNT13 antibody

Rabbit Polyclonal Anti-GALNT13 Antibody

See related secondary antibodies

Search for all "GALNT13"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat GALNT13

Product Description for GALNT13

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat GALNT13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GALNT13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GalNAc transferase 13, GalNAc-T13, KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Protein-UDP acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, pp-GaNTase 13
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUC8
Immunogen:
The immunogen for anti-GALNT13 antibody: synthetic peptide directed towards the N terminal of human GALNT13. Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI.
GeneID:
114805
Application WB
Background The GALNT13 protein is a member ofThe UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins byThe initial transfer of N-acetylgalactosamine (Galc) with an alpha-linkage to a serine or threonine residue.The GALNT13 protein is a member ofThe UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) byThe initial transfer of N-acetylgalactosamine (Galc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GALNT13 (1 products)

Catalog No. Species Pres. Purity   Source  

GALNT13

GALNT13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for GALNT13 (1 products)

Catalog No. Species Pres. Purity   Source  

GALNT13 overexpression lysate

GALNT13 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn