TA342063 CNTNAP3 antibody

Rabbit Polyclonal Anti-CNTNAP3 Antibody

See related secondary antibodies

Search for all "CNTNAP3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human CNTNAP3

Product Description for CNTNAP3

Rabbit anti Human CNTNAP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CNTNAP3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CASPR3, Cell recognition molecule Caspr3, Contactin-associated protein-like 3, KIAA1714
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZ76
Immunogen:
The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA.
GeneID:
79937
Application WB
Background The specific function ofThis protein remains unknown.The protein encoded byThis gene belongs toThe NCP family of cell-recognition molecules.This family represents a distinct subgroup ofThe neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.The protein encoded byThis gene may play a role in cell recognition withinThe nervous system. Altertively spliced transcript variants encoding different isoforms have been described butTheir biological ture has not been determined.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn