TA342055 KCNK4 antibody

Rabbit Polyclonal Anti-KCNK4 Antibody

See related secondary antibodies

Search for all "KCNK4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat KCNK4

Product Description for KCNK4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat KCNK4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNK4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KCNK4, Potassium channel subfamily K member 4, TRAAK, TWIK-related arachidonic acid-stimulated potassium channel protein, Two pore K(+) channel KT4.1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYG8
Immunogen:
The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA.
GeneID:
50801
Application WB
Background Potassium channels play a role in many cellular processes including maintence ofThe action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.Potassium channels play a role in many cellular processes including maintence ofThe action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow.This gene encodes one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains.The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additiol publications.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNK4 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNK4

KCNK4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn