TA341957 KIAA0494 antibody

Rabbit Polyclonal Anti-4732418C07Rik Antibody

See related secondary antibodies

Search for all "KIAA0494"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KIAA0494

Product Description for KIAA0494

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KIAA0494.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0494

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EF-hand domain-containing protein KIAA0494
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75071
Immunogen:
The immunogen for Anti-4732418C07Rik antibody is: synthetic peptide directed towards the C-terminal region of 4732418C07Rik. Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL.
GeneID:
9813
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA0494 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA0494

KIAA0494 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for KIAA0494 (1 products)

Catalog No. Species Pres. Purity   Source  

EFCAB14 overexpression lysate

EFCAB14 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn