TA341913 Neuroplastin / SDFR1 antibody

Rabbit Polyclonal Anti-NPTN Antibody

See related secondary antibodies

Search for all "Neuroplastin / SDFR1"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Neuroplastin / SDFR1

TA341913

More Views

  • TA341913

Product Description for Neuroplastin / SDFR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Neuroplastin / SDFR1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Neuroplastin / SDFR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NPTN, SDR-1, SDR1, Stromal cell-derived receptor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y639-2
Immunogen:
The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN.
GeneID:
27020
Application WB
IHC
Background This gene encodes a type I transmembrane protein belonging toThe Ig superfamily.The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Altertive splicing results in multiple transcript variants. [provided by RefSeq, May 2009].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn