TA341910 NNT antibody

Rabbit Polyclonal Anti-NNT Antibody

See related secondary antibodies

Search for all "NNT"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NNT

TA341910

More Views

  • TA341910

Product Description for NNT

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NNT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NNT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NAD(P) transhydrogenase, Nicotinamide nucleotide transhydrogenase, Pyridine nucleotide transhydrogenase, mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13423
Immunogen:
The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM.
GeneID:
23530
Application WB
Background This gene encodes an integral protein ofThe inner mitochondrial membrane.The enzyme couples hydride transfer between D(H) and DP(+) to proton translocation acrossThe inner mitochondrial membrane. Under most physiological conditions,The enzyme uses energy fromThe mitochondrial proton gradient to produce high concentrations of DPH.The resulting DPH is used for biosynthesis and in free radical detoxification. Two altertively spliced variants, encodingThe same protein, have been found forThis gene. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn