TA341896 CHIC2 antibody

Rabbit Polyclonal Anti-CHIC2 Antibody

See related secondary antibodies

Search for all "CHIC2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CHIC2

TA341896

More Views

  • TA341896

Product Description for CHIC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CHIC2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CHIC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTL, BrX-like translocated in leukemia, Cysteine-rich hydrophobic domain 2 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKJ5
Immunogen:
The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI.
GeneID:
26511
Application WB
IHC
Background This gene encodes a member ofThe CHIC family of proteins.The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures andThe plasma membrane.This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHIC2 (1 products)

Catalog No. Species Pres. Purity   Source  

CHIC2

CHIC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for CHIC2 (1 products)

Catalog No. Species Pres. Purity   Source  

CHIC2 overexpression lysate

CHIC2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn